DPCstruct | MC28483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 105 ± 21 aa |
| Standard deviation of domain lengths | 20.78 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 79.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J1FK64 | 27-109 | SPVQAQYRPETDLQELFRDVQLLPVFPDSKTFADCVPLQEPAHILQAYREQHAQPGFDLKEFVLEHFLLPTQPSSNFTTDTSL |
| A0A6J5K0T6 | 29-145 | RLKPLHRAAAVSSVALLISLSSVCRADTQVGGTLPPAPDKLYGELFVAVQTAQIYPDQKTFVDATPNADPAAIVQLYQQQKNNPGFS… |
| A0A376W430 | 1-116 | None |
| A0A819JA66 | 1-85 | None |
| A0A059WZG8 | 1-102 | None |
| A0A1I7V9C4 | 1-137 | None |
| A0A074TW93 | 1-111 | None |
| A0A813VUD5 | 2-87 | None |
| A0A378E712 | 58-205 | None |
| I5C2A4 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.