DPCstruct | MC28482
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 8.10 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 93.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7W674 | 204-285 | TARIAELEAEIAKRRRSNWILSQTIHNIMVGNQSAWIEWQQGDGAEKAMEWIQNGLIGPGLIPVSNGKSAQEFCDANSDYRM |
| A0A2U1BNK4 | 130-211 | ELKADYEVARMRIKEMDLLFGRYILAMRSALIEEEHGKGPAAAMEWIYNSLAGPGELPPEGETDSQAYFDREIVAVDNGMQE |
| G9YBE3 | 53-137 | None |
| A0A3G5KMP9 | 1-106 | None |
| A0A7V8EZS0 | 40-120 | None |
| A0A1B2F5V4 | 60-149 | None |
| A0A1B8V894 | 54-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.