DPCstruct | MC2848
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 91 ± 7 aa |
| Standard deviation of domain lengths | 7.06 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5K497 | 87-174 | LLSYEKTGYDTTTTSRLPDCLVEWSVKRLKEAGAQAVKFLIYYDVDGDAQVNHQKQAYIERIGSECVAEDLPFFLEILSYDEKIKDNK |
| A0A1R4IQM0 | 2-84 | LLAYEQTGFDPDQPGRQPRLIEDLSVARIVEEGSDGVKLLLYYDVDESDEINDKKKAFVERVGSECVGKDVPHFLEILTYDAN |
| A0A7Z1XTU5 | 35-138 | None |
| X1L9B4 | 4-105 | None |
| A0A6G8G2V6 | 210-308 | None |
| A0A0R2DKZ1 | 29-117 | None |
| A0A1F8N6J2 | 1-89 | None |
| A0A4D4KTN7 | 52-140 | None |
| A0A239XFU8 | 35-123 | None |
| A0A3R8R111 | 81-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.