DPCstruct | MC28479
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 120 ± 10 aa |
| Standard deviation of domain lengths | 10.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812T3C6 | 170-289 | GEGAQGGEGTQGPEDGDQVMADSVQKVEEVIESNGSLFFSSIPKQMRKGRGETAEETTKLHMDRTLQLEQMLAREYSGNELAMLGEL… |
| A0A453A8K2 | 1-116 | MDRAPQTDMERRLMEQLREDKFAKKAPAQPERRGCYYTTIPASVKHRNISADELTLLNLDRTSLLETVLAKSYQGQEDLLLGELQFS… |
| A0A444GEM3 | 235-356 | None |
| A0A1R2BPQ6 | 137-234 | None |
| A0A1Y1IGB0 | 386-500 | None |
| A0A835VNJ7 | 488-623 | None |
| M8AJT0 | 447-572 | None |
| A0A1D6EFH8 | 1-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.