DPCstruct | MC28476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.10 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 53.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A565BYZ6 | 11-78 | LSHIPLETRQSISRIGNAIQVLSNLGFTITLEVIMETVNLSNTENIDIHDMRGSEFYVVVSENEAERR |
| A0A7N2MP27 | 30-102 | NTHSDRDKAEHMWIANAVRVLSILGFNITIEVIRDTMNLSSSLNLDIHEMLGSEFCVLVAEGEAEQRSLTKKK |
| A0A803L3Q7 | 147-225 | None |
| A0A565ALU1 | 248-323 | None |
| A0A484M1C8 | 63-130 | None |
| A0A540LU77 | 169-241 | None |
| A2Q2J1 | 87-163 | None |
| A0A438F457 | 738-811 | None |
| M8BUN4 | 98-165 | None |
| A0A1J6I2K1 | 5-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.