DPCstruct | MC28473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Standard deviation of domain lengths | 10.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I3SF45 | 15-128 | TSLPETATHRHPVFTRIRLAVPSDVPHIHKMTYQMAVFERLTHLFATTESSLTSTLFSPDNKPFHSFTVFILEVSSNPFTDTHFDND… |
| A0A7N2MDS6 | 1-97 | MATDIGHQLFTRIRLATPLDVPNIHKLIHQLAMIESLDQHFSATETTLSSPLFTSPPLQSVTIFILELFQAPFSPTPTPSLFFSPIT… |
| A0A833RJ19 | 1-110 | None |
| A0A6D2K5K0 | 11-124 | None |
| A0A0A9N784 | 2-115 | None |
| A0A5C7GYD4 | 22-111 | None |
| A0A4V6D3B9 | 80-193 | None |
| M1B6L4 | 21-136 | None |
| A0A176VS21 | 498-607 | None |
| A0A3Q7HS77 | 7-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.