DPCstruct | MC28470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 11.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 30.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A431LDL1 | 1-95 | MSANNGIYILKTKATNGAFEYRVREVHAIENLFDGNNGNLPREKELCSLFGASEILKEDFDAFSVANDLLVELEEQGLEVEFGVLVL… |
| A0A355UF31 | 1-88 | MSADNGVYILKTADGQYRVKEFSAIDNLNWSFIHFRPEHYVPTRILEYFGNCKHTYNRDTALNIAQNIYNHLHVCEYGIQTIPINRTW |
| A0A7T5RER3 | 1-119 | None |
| A0A0F9Y2X2 | 1-116 | None |
| X0Y4G6 | 1-82 | None |
| A0A6M3JFT9 | 1-94 | None |
| A0A4Q7PL76 | 1-89 | None |
| A0A431LBV7 | 1-102 | None |
| A0A842UK04 | 1-92 | None |
| A0A413W759 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.