DPCstruct | MC28467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 137 ± 22 aa |
| Standard deviation of domain lengths | 22.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 84.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S0D0A1 | 474-607 | PSLRWRDGWQLYHLDGIRVNKQLVEAPETITVDDIENEENIEIRRLMLDRYGIKEYLVEVGAKEIDRDQYGVLYRHVVHDAIEPLLM… |
| A0A1F9UI61 | 20-137 | FDTGVDRGGYIRGMTVPPYLVELPPEKINPREIICIKNAEVRREFVRKVGIERIVAALNATVVDKSGDYELLLLDIGEGSPRPYLRM… |
| A0A6B1MF32 | 11-143 | None |
| A0A6P1A9N5 | 368-487 | None |
| L7KQY4 | 128-285 | None |
| A0A1G0QR24 | 258-403 | None |
| A0A7K0C4F1 | 190-332 | None |
| A0A0F9KNX6 | 76-230 | None |
| A0A101G4I0 | 207-333 | None |
| A0A6M3JMH1 | 151-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.