DPCstruct | MC28465
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 91 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.85 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | PF13700- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0T7C0M7 | 1-101 | MASIERTAYPRFKRYYTANELDKIYTPTRIEIAFALKVTTGEENYFNLLVLLKVFQRLGYFPKIADIPLTIINHIRTALDLREDKSF… |
| D6U393 | 1-82 | MTAIERTAYPRFTRAPSAKELRELYTPTSAEKDFVNSKVRGASQKFALMILLKVYQRLHYFPEPQTIPGSLIGHVRDSLRLP |
| A0A0F2KKQ0 | 1-105 | None |
| A0A069IED8 | 1-63 | None |
| G5CJ90 | 4-75 | None |
| A0A0M8Y0T2 | 1-96 | None |
| A0A2A7WY58 | 1-94 | None |
| A0A443W146 | 1-81 | None |
| A0A514LL83 | 10-101 | None |
| A0A6B3N4H1 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.