DPCstruct | MC28457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 147 ± 13 aa |
| Standard deviation of domain lengths | 13.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C5M6Z6 | 188-332 | LYVTKSYDSMADMSEITESSDLAPKSEEYLRKIIALAKEEDIPLVFMISPYQGIVESEQMIFNRCGEIAEEEGIPFLDFNRMYDELG… |
| A0A373A763 | 3-146 | GNLMLFRFDENSNRTVDVFEVENTDKIEEINNYNMLYLKKMVDLCDQKEVKLVFVRGQRQVDWSWDKYNTIERVASEYGVDFMDINL… |
| A0A3D5WNN7 | 16-157 | None |
| A0A6L9HGW9 | 390-563 | None |
| A0A373BPN4 | 160-319 | None |
| A0A3R6U6C0 | 173-318 | None |
| A0A355TUF0 | 106-244 | None |
| A0A251WQ79 | 152-316 | None |
| A0A349DAB7 | 1-131 | None |
| A0A1I0YXD2 | 186-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.