DPCstruct | MC28456
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 150 ± 27 aa |
| Standard deviation of domain lengths | 26.89 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.56 |
| Pfam Score | 84.67 |
| Assigned Pfam label(s) | CL0267- CL0196- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834E5W5 | 1-138 | MTAKEGRKKSVRVLVVAGNGRGAAGFAVGKATERSDAFRKAKNRAVHYLHYIERYEDHTIFHDISLTFKRTHIKMKKQPRGYGLRCH… |
| C7LKI6 | 19-175 | KINLDLKEKLVVVNRVCKVTKGRRYFSFTALVIKGDKKGLVGYGFGKAKEAPDAIAKAGEKAEKKLLKINIIKGGTIPHEQEAKYGG… |
| A0A3D5A364 | 15-165 | None |
| A0A091B0N3 | 6-146 | None |
| A0A835Y2T2 | 2-140 | None |
| A0A1I8HXS2 | 364-483 | None |
| A0A286XN44 | 15-169 | None |
| A0A523D2W9 | 11-160 | None |
| A0A1A9XS07 | 187-332 | None |
| A0A811MIE1 | 116-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.