DPCstruct | MC28453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 126 ± 18 aa |
| Standard deviation of domain lengths | 18.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N8YP48 | 73-181 | HPSLRNFSKPDLQFKTTKFQIRIDEMPNGQYRYAAWGVNQSQTEKPDLILNQGKVVMDGSGGDHHYIFNSGGYQYIIYRNLLGTSET… |
| A0A6I4T987 | 108-221 | GEDAPPAPYAGSVFACSLGDEAVYVSETDGRYTYRYGKSGAPELTLIRQADELTSTHDFGTLDGIKELRFDNGEYSYVLFFEGLSDN… |
| A0A3K2XDA6 | 171-318 | None |
| A0A3N6V164 | 2-137 | None |
| A0A0P1G159 | 1-138 | None |
| A0A352AIU4 | 54-150 | None |
| A0A1M5RLU4 | 7-143 | None |
| A0A6B2BJQ2 | 1-141 | None |
| B2PWQ4 | 4-106 | None |
| A0A3G8LQT6 | 48-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.