DPCstruct | MC28450
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 190 ± 23 aa |
| Standard deviation of domain lengths | 23.48 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V3SX95 | 22-227 | VASDPVQDHQDATTALEKAICQELNHPPLGAFTEVPDRRGTVIEKWTRRLAKAEPTPLHALLVMDGSPVDARFVDPLTGMPVLRSPD… |
| A0A0J8U9R0 | 151-329 | IGCTIRSGPGRGPLAQEWVTRLKPIGSDPESLGSMFAEAKLTTEQLGSAQWSWWEDYENPDCWAIRSADDVVDATVGTRIPGIDGRW… |
| H2KAD7 | 1-197 | None |
| A0A7X0K6G4 | 133-302 | None |
| A0A1Q4VJ69 | 15-149 | None |
| A0A1V2Q4D7 | 93-286 | None |
| A0A399GHD9 | 1-240 | None |
| A0A1S1NI81 | 318-513 | None |
| A0A1I2CH00 | 917-1113 | None |
| A0A0M9YEK2 | 243-421 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.