DPCstruct | MC28447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 234 ± 46 aa |
| Standard deviation of domain lengths | 46.05 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A372R7R1 | 101-343 | QNFESLYGHYQKAIIDSLIYIQEARINSINYKINELELERKKQEEIYEIGKINRKIDLKKQELNSQINSNWQLSDIFRGVKGADTLL… |
| A0A0G4I215 | 56-282 | RCAHKQGWKKELLKHVPLGFAPLLKEEKDRSPDGREFEEYGLRLRVLRSHFREDGENVKYSELHRGAKLHGDADFLVENRHLSVEKF… |
| F4PMT0 | 790-1043 | None |
| A0A2N0QN25 | 58-337 | None |
| A0A813BVC1 | 1-292 | None |
| A0A813A562 | 303-542 | None |
| G4ZB97 | 327-706 | None |
| A0A7S2XUH1 | 512-732 | None |
| A0A833T2S9 | 315-568 | None |
| A0A3N4LVK8 | 144-416 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.