DPCstruct | MC28446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 148 ± 11 aa |
| Standard deviation of domain lengths | 10.77 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 51.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G4HHX3 | 51-212 | TACPKFAGKKEIVDFTSQWGEFSNVHLQRKYFRSTEESLWRSNIIIALNKAGSDARAFRRDVRRWRRKRVNPEDIVEKMKQEYSSTL… |
| A0A0G4I112 | 1-162 | MAAVPKFEGKQHIQEFADLWAPYTRVYLKRSNFDSDQEWCDNIILALNHAANGNRQFKADVRKLRKGKKIPVEQVVDKLLEEYESAL… |
| A0A0G4F2X0 | 138-277 | None |
| A0A0G4GM77 | 167-294 | None |
| A0A0G4G1I0 | 104-257 | None |
| A0A0G4FP33 | 1-143 | None |
| A0A0G4IEM6 | 32-173 | None |
| A0A0K6S802 | 46-186 | None |
| A0A0K6S6Y0 | 51-194 | None |
| A0A0K6S988 | 1-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.