DPCstruct | MC28444
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 5.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 32.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C9A1E3 | 125-220 | GGHSGILYLLVACALRAADVDFLLFAGNKAVRRSIARCGFSPRPIQAARPECLPDGGRCWGSYYASEPVVMLADIRRIVRQAGTQPG… |
| A0A2M8DER8 | 1-99 | MIIALTCYLHQTRAVWVCFTGGPVLRNAFCRLGLAPVCLAAARPEALGVAAAQWGRYYDQHPHLFAGRVEEGFHSLSGGLTAEQLIG… |
| K2KC37 | 109-201 | None |
| A0A0W1GQ80 | 94-183 | None |
| A0A2A2K4Q9 | 123-210 | None |
| A0A4Y4GRL6 | 158-258 | None |
| A0A1H5UPJ0 | 127-209 | None |
| A0A8A5E6S2 | 44-130 | None |
| N9P3S5 | 51-133 | None |
| T1XJ44 | 121-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.