DPCstruct | MC28438
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 4.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 43.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V9AJ42 | 92-156 | TVQVEMLPNARINPLFYATVQATEEAITNAMVAAETMTGADWFRVHALPHDRLREALAKYNRLDA |
| A0A822GX49 | 1-70 | STIKVAEFLSNEQINPLFDATIQCVEEAIINSLIAAETMVGYGGNRVEAISHDNVIKILKKYNRLNDRKE |
| A0A3S9E8N1 | 39-104 | None |
| A0A7J3XCJ4 | 16-76 | None |
| A0A819QPL6 | 1-66 | None |
| A0A820Q0X1 | 1-58 | None |
| A0A842P399 | 79-135 | None |
| A0A7V9JFG3 | 119-185 | None |
| A0A850SMQ0 | 12-69 | None |
| A0A1Y2EKV3 | 59-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.