DPCstruct | MC28435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1981 |
|---|---|
| Mean domain length (aa) | 154 ± 29 aa |
| Standard deviation of domain lengths | 28.99 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.29 |
| Pfam Score | 98.75 |
| Assigned Pfam label(s) | CL0213- CL0125- PF03140- CL0027- PF07589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7J9Z9 | 4-125 | AQEILRLVNVERQRVNAPPLVLNDKLTTAAQRHAQDMATSRRMSHTGSDGSTMRSRIDATQYNWSTIGENVAMGQPTAAAVMAAWMS… |
| A0A822GVS0 | 16-173 | STQTITTTSTPTTFQQQALLQHNYYRQLHCTDALVLNSTINAIAQTYANYLAANNLFQHSGTSGLGENLWAIWSSGAIRSVNGSSPT… |
| A0A0W0W7A9 | 20-164 | None |
| A0A1I8ICJ4 | 34-190 | None |
| A0A1I8I3K6 | 405-573 | None |
| A0A1I8HWQ0 | 1-122 | None |
| A0A0K0EI79 | 172-312 | None |
| A0A0K0EEW7 | 132-303 | None |
| A0A1E5RI64 | 682-861 | None |
| A0A0K0EC49 | 22-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.