DPCstruct | MC28431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 11.56 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 54.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7W7V2 | 91-186 | YYQLEYGGELIDIQSDPRKDDRVTGFSPDAWQRRMLDSVDRGNSAVIVAPTSAGKTFVSYYCIEKVLRNSDDDVVVYVSPSKALINQ… |
| A0A0C2FTZ1 | 4-100 | VYYQLEYGGELIDIQSDPRKDDRVTGFAPDAWQRRMLDSVDRGNSAIIVAPTSAGKTFVSYYCIEKVLRQSDDDVVVYVSPSKALVN… |
| A0A822CZ35 | 1-110 | None |
| A0A820Z9K0 | 177-301 | None |
| A0A4D6Q3Z7 | 75-177 | None |
| A0A368F7P4 | 492-586 | None |
| L5MF96 | 652-742 | None |
| A0A817GCS4 | 486-610 | None |
| A0A0L0MZ63 | 350-443 | None |
| C4V8W9 | 482-580 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.