DPCstruct | MC28427
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 168 ± 28 aa |
| Standard deviation of domain lengths | 27.66 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 27.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7I9I2 | 1-135 | MEEMEKSIKEFEDEKKFIFECASFFGAFLKKNAMIAYNDSFNEYLDMLIKDEQAKEKEIRDDQKIEQMKQDKKTYNANKDIILDSIA… |
| A0A822G0F9 | 2-179 | CTKCKCSWKKHQHITYGYETNIRRLTEASSLSDIDKRISDLRDEKSKIEDVYKKLSKFLHANAILPLNDDILEYLKLFIKEEQMKKN… |
| A0A814PHW6 | 150-298 | None |
| A0A2N0RRT4 | 235-392 | None |
| A0A819D6L5 | 378-505 | None |
| A0A2N1MZG8 | 1-188 | None |
| A0A822D1Q6 | 2-166 | None |
| A0A7R9L3N5 | 383-536 | None |
| A0A2B4SN90 | 149-276 | None |
| A0A820FDY3 | 68-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.