DPCstruct | MC28424
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 324 ± 26 aa |
| Standard deviation of domain lengths | 25.98 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822FWS1 | 26-355 | LNENDAASAARLSTTIDRLEDLQKELNAKTEKENLMTKTAEQISTAHYTVPKSNQSILSKFNLIVNTLRKLSYPLKEYFKDNIPLID… |
| A0A819Z6B7 | 145-438 | NEIKVINYNKISKRIVHDFLTAGHALIYDQLKNSTDKFDDYVMTRIPNMIFSGKTNTFTVSITGLDEHHKTFKGILKGLTDLSLMAE… |
| A0A820XAS6 | 514-844 | None |
| A0A819GWM0 | 254-609 | None |
| A0A815ARM8 | 865-1195 | None |
| A0A816ZZS4 | 99-456 | None |
| A0A819W0R1 | 145-438 | None |
| A0A816SL46 | 4-293 | None |
| A0A815J751 | 199-550 | None |
| A0A820SQW1 | 49-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.