DPCstruct | MC28422
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 3.52 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 58.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S4P6H6 | 1-68 | MKAWNVNWEIKHMMVQFEEGNIIFSVQSADCKVVHEFIGGYIFLSMRSKDANQTLDEELFHKLTGGWT |
| A0A822FW81 | 11-87 | ISRMRSWKVNWENKLLSIEFDGETIEFSPLYDINSKCIHEFIGAYIFLDMRSTMKMSDNDNSLQQEKLFQQLTAAYT |
| A0A6P4TEX9 | 148-215 | None |
| A0A7R9JA31 | 79-149 | None |
| A0A673HFG0 | 369-438 | None |
| A0A3P7LRD6 | 582-647 | None |
| A0A2G8LIZ9 | 379-447 | None |
| A0A673WE26 | 435-503 | None |
| S7MQ85 | 242-309 | None |
| A0A0R3U3E0 | 785-848 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.