DPCstruct | MC28421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 134 ± 13 aa |
| Standard deviation of domain lengths | 12.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 40.41 |
| Pfam Score | 77.86 |
| Assigned Pfam label(s) | CL0680- CL0743- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I4AWV6 | 183-330 | GDLFIDSLQDHIDATKLFKEELTQVKEGMKQINELAHQLAISDVHLSMENARALEHLNSRWKLLQGSIEERLKQLQDAHRDFGPGSQ… |
| A0A822FV79 | 17-137 | QQLAQTIENEYDIHPTNRVQELNQRWEHSIQSLSQRVQLLQDSVKTSESDIYSKSVEYPWQRAIAFNKVPYFINHSDQSTSWDHPKM… |
| A0A6J1NL30 | 256-394 | None |
| A0A183WP44 | 6-147 | None |
| A0A0N1PJC3 | 129-257 | None |
| T1KPK1 | 223-354 | None |
| A0A6I9YR16 | 231-342 | None |
| A0A1I8I7P8 | 2-104 | None |
| A0A7J7YF51 | 26-149 | None |
| A0A4C1W103 | 51-195 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.