DPCstruct | MC28420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 131 ± 12 aa |
| Standard deviation of domain lengths | 12.28 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 50.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818XYK0 | 1-116 | MTQPNEQLRIIAQPKALYRERYGSEHFKTGNRVQRYIRAEDNQLNFEYPTIEIRREWSDAALPQYIRVASVTVPNDMESIVCVHPYP… |
| A0A822FUN7 | 1-116 | MAELNIPLRIIAQPKALYRERYSCEIDQSRKQSPRFIRAETNLFRLEYPTIEIPQQWDSQGLYIRVTLVTVCSKEVPVRYIHPYPID… |
| A0A815LCH3 | 1-142 | None |
| A0A821KSS5 | 1-141 | None |
| A0A821SIS7 | 1-114 | None |
| A0A817I5Q7 | 66-187 | None |
| A0A822BSE1 | 1-142 | None |
| A0A819Y5Y5 | 1-128 | None |
| A0A814EKY5 | 1-144 | None |
| A0A817AU39 | 110-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.