DPCstruct | MC2842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 118 ± 17 aa |
| Standard deviation of domain lengths | 16.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 19.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08598 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K3X300 | 19-126 | RLPLDDINADLTNILGSRQQTAAETTARLPQKTIDNFKSERRRLFCGKYILEDGDEVVISSPIIKEDYIGTISSITDDAVFVKLSSG… |
| A0A836CNX5 | 5-101 | RERAVSYLNHCGQGAADWCHVEPAEGVGGAAAARIDGALLTVGDKVSIWSRLTGEEFQGEMTAVVGPEVFVRLTGNIPTRLHMDHLR… |
| A0A146LL17 | 290-421 | None |
| A0A7J7IUB1 | 13-113 | None |
| L2GYM1 | 53-169 | None |
| A0A812N466 | 37-163 | None |
| A0A7J6CYB2 | 239-342 | None |
| G3IJU3 | 2-91 | None |
| A0A6V7Y6I5 | 1-109 | None |
| A0A1A9WB20 | 393-516 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.