DPCstruct | MC28418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 55.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02936 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R8ZHB1 | 245-311 | RLKLGNREIVGFGTNGSPIYMDRFDSPFPAIKWKETTPELQQLHEKEKGDWNKLSIEEKKELYRWNY |
| A0A820CG56 | 70-133 | IGNREIVGYGLKGKPEYFDLVMFPCPSIRWEADTSEIAELRKKEKGDWKQLSTEDKKRLYRASF |
| A0A0L7L8C7 | 19-101 | None |
| A0A3P8FGR4 | 21-99 | None |
| A0A1A9VNC7 | 34-109 | None |
| A0A6H5IHE5 | 44-110 | None |
| A0A4E0RTA5 | 30-96 | None |
| A0A8B6EE61 | 46-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.