DPCstruct | MC28415
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 481 ± 27 aa |
| Standard deviation of domain lengths | 27.34 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420NKZ5 | 1-423 | MQQHIAILDRLNSRAGFSDDKNLLRAKCKLWELGRTLEHWTQIGCQLCYVRGDMGLDHQLDDCTAAGSKVAQRLCGWLEARDLDRYI… |
| A0A4U9FF58 | 2-472 | QSDYQQQGLGSKPPPPKRKRTLPPRLKGNNIPDQSPGNNTQGHWPLFGHLDSSTSTSATNKRQAILDHLDDQATFKKGDEDYKIHMK… |
| A0A014PI63 | 249-725 | None |
| A0A6M7Z9E3 | 64-532 | None |
| A0A0F7ZRL0 | 703-1208 | None |
| A0A0F7ZQT7 | 38-538 | None |
| A0A0F7ZHU1 | 132-650 | None |
| F9F3N4 | 382-879 | None |
| A0A365MTA3 | 703-1145 | None |
| X0C5T6 | 16-515 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.