DPCstruct | MC28412
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 136 ± 39 aa |
| Standard deviation of domain lengths | 39.38 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 87.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6ELC7 | 6-112 | QRVSREHLTGDAESSVFVANSCESYQGFMLTTPGENALYHPAVVSFFHERGVDATSRPLWELPFVSSREAVTVRSEDPWRVAVTVAC… |
| A0A2R6FC25 | 2-95 | FDAGVRYVCERCGEDMNANVEASVISHPAVVAFYHDYGIDGFETPIWGFDWAVQPSATVVSEDPLRVNVPVERDGDRLVLTIDGDAA… |
| A0A6B0GLR0 | 180-287 | None |
| A0A7V9VJY6 | 23-220 | None |
| A0A830FBE8 | 91-242 | None |
| A0A256IH18 | 166-342 | None |
| A0A2R6GG73 | 3-109 | None |
| A0A2R6CS20 | 34-212 | None |
| A0A2R6CQB0 | 159-320 | None |
| A0A0P7GCV9 | 28-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.