DPCstruct | MC28407
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 161 ± 27 aa |
| Standard deviation of domain lengths | 26.76 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5F2CLS2 | 10-162 | EFREKLRNFILFESARRFHDSLSLKEFERASWIAKIFRETVSFLGIGEATVEGVKSKNLYSARQYFAADLIAYTGQAKDSQFVSLIT… |
| M6RUA9 | 10-182 | PDFLANMESLKKIKFESEEYNQLTKWCEFEYSKYIKLLHGGKYPEARDKITNLFTTKGEDFLKLNQWEVKLKISESYYRKAEAFATV… |
| A0A2N0BLW1 | 2-103 | None |
| A0A420E5T6 | 291-483 | None |
| N1WCU1 | 1-105 | None |
| M6JE21 | 7-183 | None |
| M6GFG1 | 156-333 | None |
| M6VPJ6 | 3-138 | None |
| A0A1T4R7W4 | 569-721 | None |
| A0A3B0XUK8 | 115-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.