DPCstruct | MC28405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 80 ± 11 aa |
| Standard deviation of domain lengths | 10.94 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00696 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A537FNZ0 | 1-94 | MKVLVSLGGNAILQHGQKGTAEQQATNVQNTAKHLARLLRRGERITITHGNGPQVGNILLQNEIAKDILPPMPLDVCGAESQGMVGY… |
| A0A7R7Z4A5 | 3-82 | KRAVIAVGGNAILQPHQAPTFEAQLRNVQVTAAQIAKVEAMDYEIVLTHGNGPQVGNVLQQNDIAKDVVPPFPLDACNSE |
| A0A101GMU0 | 3-83 | None |
| A0A090SKV1 | 1-84 | None |
| A0A6A5KZH3 | 258-341 | None |
| X6PBE8 | 211-291 | None |
| A0A376VNR0 | 2-72 | None |
| W7C657 | 103-196 | None |
| A0A7X0U3F3 | 2-79 | None |
| A0A2X3JPG3 | 2-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.