DPCstruct | MC28403
Metacluster Properties and Pfam Annotations
| Number of structural domains | 104 |
|---|---|
| Mean domain length (aa) | 125 ± 27 aa |
| Standard deviation of domain lengths | 26.64 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G3E9Q2 | 44-154 | TNGNVTVYLVHQTKTTTQTKTVTRTIKITNPSGETTTTTQAAHFTREATTDAVTGEVTYGDWTSLDNSFSALSVPEVAGYTASQTTV… |
| A0A656YAJ6 | 87-209 | HKHTTFNPQNPGQPNEPLNPKDPTGPKVTQAMLDYQETYTATVHYEGAGKDTPVDNVQRSTWTRSITVDNVTGGILNTTPWVSTDSY… |
| A0A7U9WXA7 | 84-195 | None |
| A0A0R1NZN9 | 100-242 | None |
| A0A844FKM4 | 28-109 | None |
| A0A844FPB5 | 36-135 | None |
| F6IYW3 | 321-416 | None |
| A0A3F3H8P6 | 315-441 | None |
| A0A7X9RL24 | 810-900 | None |
| A0A0R1PP38 | 20-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.