DPCstruct | MC28400
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 99 ± 9 aa |
| Standard deviation of domain lengths | 8.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A250KMF2 | 2-86 | RKFTVEFRGKPLAKLPFGTKPEPVVTVSRGELSRIEIEAVPDGVAGHWRTHFDLAVAGTDPVEMRCYLRVKDKAMSETWLYQYHP |
| A0A7C7QWH8 | 47-141 | LNTAIGGNWDRSRTLVSVDFADHPALSGAPDSYTKIVRTNRGDVTEGVLERNPRTGGLRLTFALDPGEHPSMELRAQLLLDEQTVTE… |
| A0A2V0QDF1 | 10-103 | None |
| A0A6A5KY21 | 1059-1166 | None |
| A0A1W6ZIV4 | 522-634 | None |
| A0A383EH20 | 3-94 | None |
| J2KVH3 | 360-453 | None |
| A0A7W6TT21 | 90-182 | None |
| A0A259LKT7 | 12-114 | None |
| A0A520I684 | 31-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.