DPCstruct | MC2840
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 115 ± 18 aa |
| Standard deviation of domain lengths | 17.72 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 32.08 |
| Pfam Score | 99.31 |
| Assigned Pfam label(s) | CL0010- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N0DV68 | 82-184 | ARDLEKHQKGQIASRYPFFAPNYEIKPWLWYPGDIVEVTSGEGVGQRGSIIAVVKYKNEILVQNINVQDVVIPASETRPEQVVQREH… |
| A0A836CNT1 | 7-135 | IPACRRKSKKPKEERNPSHKKRIIMTAKFSKELQSEYNMRSLPVRKQDEVRVLKGHFKGREGKVLACYRSKYIIHIEGCVREKATGT… |
| A0A2P6W507 | 15-155 | None |
| A0A0R3QLM6 | 30-159 | None |
| A0A447G7I3 | 5-123 | None |
| A0A397ELX8 | 289-415 | None |
| A0A432F676 | 7-96 | None |
| A0A0R2P1M3 | 2-123 | None |
| A0A6L2ZTI5 | 9-112 | None |
| A0A7D6BQR4 | 7-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.