DPCstruct | MC284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.33 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q6N720 | 1-63 | MKSTEKGYVNDNNQRNNGRTNKPGTDYGQWFYEMECLNSNCGHKYYANGTDIWLRKCPKCQGG |
| A0A2D8P8F0 | 4-64 | GYSTRTGFVNDRGQVVIRCTDKKGTDHMQKIYQMACSECGNVYGANGSDTHLRKCPICQGG |
| R7C850 | 84-146 | None |
| A0A840R563 | 285-354 | None |
| E8UZS8 | 7-70 | None |
| A0A842I3G4 | 328-396 | None |
| A0A1H0R0N5 | 106-175 | None |
| A0A1G7NLH9 | 20-85 | None |
| A0A099KGN2 | 243-311 | None |
| R5F608 | 147-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.