DPCstruct | MC28397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 54 ± 3 aa |
| Standard deviation of domain lengths | 3.11 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 66.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0HM80 | 16-62 | SHVRVLARIPAGHPRGSWPAEQLAAENAADVVMDLKTDDYLVVTRAV |
| A0A5B7V5X2 | 18-72 | PRRVLARFPAGGPRGSWPAEREAERLRREGVPAEVRMDLVSDSFLVVAEDHGKSK |
| A0A1V6MQR1 | 177-228 | None |
| A0A6M4WSS6 | 2-56 | None |
| A0A6I5NDN2 | 7-65 | None |
| A0A1C4QGX1 | 1-51 | None |
| A0A0N1GTS5 | 20-79 | None |
| A0A5P2CCQ0 | 1-56 | None |
| H2JTZ1 | 130-186 | None |
| A0A387HML3 | 2-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.