DPCstruct | MC28394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 181 ± 39 aa |
| Standard deviation of domain lengths | 39.21 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 18.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B4E363 | 19-159 | PEQAPGIPGASIAPVGACVSLDGPSTAAKLKVVDCGSPSNGYKVIQRVPTPAECPADVDHKFYMYPDEGEFTACLDYAWSANDCLSI… |
| A0A4R6SKC7 | 32-212 | YGQAPVPPKRKAPFVVAGIAIAVVLGVIAFVVVNNDHRSPVEWAKAQPSQAVAGDCIKVISASTTDARVEKVDCTSPDAVFKVGTKM… |
| A0A7I7XYK8 | 10-144 | None |
| A0A1S1NE72 | 2-128 | None |
| A0A516NI50 | 49-280 | None |
| A0A7X5TW92 | 12-170 | None |
| A0A5C7YBD7 | 9-154 | None |
| A0A4Y3R3C9 | 102-320 | None |
| A0A5M8GT36 | 23-187 | None |
| D0L6L9 | 18-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.