DPCstruct | MC28389
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 109 ± 21 aa |
| Standard deviation of domain lengths | 21.22 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 26.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177AJ78 | 420-501 | REIDINLVRWEDDTWKYLTPLAVDAEDPSNIERLVNDYMTRGIRAFNTYLRMMSPAECFQVVINNRTHTILLIAEHELAIDD |
| F0UL27 | 181-297 | TDPAGDRTNVADEEVWPPPARNDGDVTITLHIYERGQWRVADVVSIDPSRKNALEQIVRGYKRQGMILYDMGMRAVSVSSSLRAATL… |
| A0A084RQK4 | 460-560 | None |
| A0A179F1Y0 | 251-346 | None |
| A0A0S7DKH6 | 43-145 | None |
| A0A395HAC8 | 246-373 | None |
| A0A5N5WXM3 | 1-101 | None |
| A0A2V1B6Q2 | 600-703 | None |
| J5JE56 | 400-504 | None |
| G2XP36 | 375-487 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.