DPCstruct | MC28380
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 171 ± 31 aa |
| Standard deviation of domain lengths | 31.24 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 71.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05901 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A542DLW1 | 1-201 | MSLIRRTVVTVSALLISGMVGAGSASAAQDRYNCGDFATQPEAQKVLDSTPGDPHDLDRDGDGIACESLPGGPGGEPGTDPTTTKPE… |
| A0A7V9HLR3 | 1-119 | MRHAVAAISAAAFLFLTFGPAGSSAQVLLDCDYFNFQEQAQAILDEDLSDPNVLDEAGDGIACPDLPSAGPDPEFPELPANGDYGCV… |
| A0A4R6UIJ9 | 1-208 | None |
| A0A1M4SLZ8 | 1-139 | None |
| A0A852X988 | 171-357 | None |
| A0A1I0W6G5 | 1-187 | None |
| A0A2A8W4D1 | 37-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.