DPCstruct | MC28379
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 78 ± 12 aa |
| Standard deviation of domain lengths | 11.63 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 37.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428Q2V3 | 10-83 | QYTIYCVWAFVVPYMFNPGQANLGAKTAFLFGGLGVLCLVYLWFYQPETAHRSYEELDELFIKKVSVRQFANYK |
| A0A2J8EL79 | 32-104 | TYYVLNIVKTVVAPYLLNPQEANLQGKAAFPAAGLTLMLAVWAWLGLPELKGLTGETLDSLFERKVPARRFLK |
| A0A2K0W2J9 | 86-169 | None |
| A0A427Y3K1 | 207-313 | None |
| A0A0D0UXM4 | 1-75 | None |
| A0A7C8GW82 | 98-190 | None |
| A0A0S6XUN7 | 97-172 | None |
| A0A4Q4YU64 | 286-355 | None |
| A0A093V5M3 | 168-240 | None |
| W1QIT3 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.