DPCstruct | MC28378
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 261 ± 32 aa |
| Standard deviation of domain lengths | 32.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18130 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428PZ22 | 6-236 | VTWHTSRVVKIDQETDSKSNGTHHVTEHALDIHCSGSLVEPNGRKRQGYDLWLVDVDVTSRQGIENGSQELDKSDGLSDLLRAAQPL… |
| A0A369HDY6 | 32-279 | MFRCVWEDVSLNDWVNLVHVKIEAADETIHHDSVMLVPDGSRLDWMMAFSINSTAVFSLIFPVHGGFVSKADFVQARLEGCAGVRSV… |
| A0A2S7QQA2 | 1-246 | None |
| A0A7J6ILB2 | 71-372 | None |
| A0A094GDZ0 | 15-298 | None |
| A0A6S6UWH5 | 1-225 | None |
| A0A124GQ73 | 10-228 | None |
| A0A395GSU1 | 3-208 | None |
| A0A1L9ULM4 | 1-294 | None |
| A0A365N258 | 14-303 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.