DPCstruct | MC28376
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 292 ± 34 aa |
| Standard deviation of domain lengths | 34.18 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 19.90 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0203- PF01425- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0AIL8 | 10-271 | QQPEIRVPFGQLLVRYGCSLIGEFADQVGSSENDLTNQYQQLALQLRKQAADILDNIFNENEIDLIVSLANDQSPLYATAGYPAITI… |
| A0A428NII1 | 1-333 | MERGALIAHAWNDFLKGFNDSTLPDLSAVDPFNIYPESLRTEPELRHFETANAIQYHKLTDYLRNTTFFGVYGIEQAVKALEGMRKV… |
| A0A559LQV2 | 1-305 | None |
| M7BTM4 | 331-609 | None |
| A0A0U5GBE7 | 23-246 | None |
| A0A660LE71 | 828-1131 | None |
| A0A0A1TMR9 | 723-1052 | None |
| A0A5Q0NWP5 | 481-750 | None |
| A0A4S8U5Z9 | 26-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.