DPCstruct | MC28373
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 380 ± 41 aa |
| Standard deviation of domain lengths | 40.96 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6KPE6 | 1-379 | MRIKDLSRQKIEDFGEKIGGAKKDLFAHYLSQMKEIRREDIIAQPLRKIFPPPNYKALMEEGRLSQDNAILLRYLYDSIPNKPRTRY… |
| A0A513RQF2 | 1-399 | METNQLSLFQTAPVESILLDIRTEQQSSKKVAYDVGEKIGLARKDIAALRKAFEENHSGALLEEIEGFSSVLAAEVITKHELFKGFT… |
| A0A2N0AZ65 | 40-487 | None |
| R9ISL5 | 27-340 | None |
| A0A2U2B6X5 | 31-417 | None |
| A0A241W284 | 71-442 | None |
| A0A7U9PPQ9 | 13-399 | None |
| A0A7W4GN94 | 1-372 | None |
| A0A839A2J2 | 4-445 | None |
| A0A7I0BF38 | 519-837 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.