DPCstruct | MC2837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 164 ± 11 aa |
| Standard deviation of domain lengths | 11.46 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 19.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P9ARV9 | 13-165 | VKWSLMELSRAINGDGKTSPNPLFRVKVILQDNSPGQTPQVAFSPSLLQLASMVNDISSHLISSITVFRHLPEILVRRKFARDPISV… |
| A0A7R9CBW9 | 197-352 | CRSSLQIILNILHGEGVSGPSPFISLSILLVDLKLTFSPTIQEISGMVRNVKQQLVHSLRPIPRLHEKFRVPANHLVAFHESIDKDN… |
| A0A6G0YXW7 | 730-893 | None |
| A0A7J7J9K5 | 754-910 | None |
| A0A821UR53 | 108-262 | None |
| A0A817CXS3 | 218-378 | None |
| A0A183WB15 | 10-202 | None |
| A0A821CJ36 | 242-402 | None |
| H2NJ27 | 602-762 | None |
| A0A8B6GZT2 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.