DPCstruct | MC28368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 128 ± 17 aa |
| Standard deviation of domain lengths | 16.60 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8AN11 | 159-276 | HNGCNCITKNCGCCAHLLVRKIHLNDNACWNITYISEDIGLKVSFSVNDHIYISREISVRNPPPFCFDVPHLRQFAALCLKLFNVET… |
| A0A1I8NMX5 | 2-108 | CANVTYIQPKQEINLEMFLNENQSAKYAVSTRNPSPFCIPIMLNIPMSMCVQMSDVGLQGDNMHACMDFMVQLASSGLFEMHFQCMQ… |
| Q8T0Z4 | 35-175 | None |
| A0A3Q0IT39 | 5-135 | None |
| A0A7E5VUB7 | 126-255 | None |
| D6W7K2 | 48-178 | None |
| D6W6H0 | 15-129 | None |
| A0A3L8DPI8 | 8-125 | None |
| A0A2T7PVS9 | 55-201 | None |
| A0A2T7P868 | 195-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.