DPCstruct | MC28366
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 287 ± 34 aa |
| Standard deviation of domain lengths | 33.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 28.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7Y9M6 | 153-434 | GDIHTKEPEVPEGSWSDRLTTLDFPFMGRCKYEDYWLKESIKFCGRKPTNYVFGAQCGGARKYNEIIFVCDQPKKRVVNDKYDTLPQ… |
| A0A1I7Y5K2 | 1-306 | MSTHSAEASKPFGNITSQEPLVSEGSWSDRLSTAIEGTCKSEEEWLTASTEECGKKPTNYVLGAQCGDQDKYVEVTFTCDKPRTDVY… |
| A0A4U5MF61 | 5-254 | None |
| A0A1I7XY11 | 147-434 | None |
| A0A1I7ZW87 | 1-235 | None |
| A0A4U5MEM4 | 295-602 | None |
| A0A1I8AMK3 | 462-803 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.