DPCstruct | MC28365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 218 ± 24 aa |
| Standard deviation of domain lengths | 24.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | CL0110- PF12529 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183TX70 | 210-433 | GNLHLTNWKRKQGCRCAMLKKVVDWCGCSPLVFNDLDIPKFMLETSKKKVIFFGRKFDSLISQSAIAAAESQALRRTPQLVDANHVS… |
| A0A1I8AI07 | 1-176 | MVFREPKISSFHLDRAKARTVYFARKFDSMIDVNPIAAAERQSMRNRLHLIQKDHPAFNSTWVNFYSVAGDGDSRRASIYQQLSSLF… |
| A0A6A4WAG0 | 28-244 | None |
| A0A2G9RJA2 | 3-201 | None |
| A0A2H2IE15 | 2-211 | None |
| A0A1S3QSL7 | 1-210 | None |
| A0A0A9WGN7 | 75-292 | None |
| A0A183C899 | 535-771 | None |
| A0A267EM15 | 193-468 | None |
| A0A4U5VSV6 | 451-688 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.