DPCstruct | MC28364
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 10.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 63.55 |
| Pfam Score | 96.43 |
| Assigned Pfam label(s) | PF02092- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8AHP5 | 1-92 | DPLVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGIECYPVTGEITYGLERLAMYLQGVDSVYDLVWADGPFGKVT… |
| A0A811S919 | 182-271 | GINIREHDIRFVEDNWESPVLGAWGLGWEVWMDGMEITQFTYFQQSGSLPLQPVSVEITYGLERILMSLQGVDHFKNILYTEGITYG… |
| A0A3M3E554 | 337-430 | None |
| A0A1G5C4T2 | 490-578 | None |
| A0A5S9Y8D3 | 75-143 | None |
| A0A6N2NG88 | 66-156 | None |
| A0A484XRG2 | 39-133 | None |
| A0A133S0N3 | 345-434 | None |
| A0A150NTB8 | 106-227 | None |
| A0A0M5KP39 | 94-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.