DPCstruct | MC28362
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 96 ± 7 aa |
| Standard deviation of domain lengths | 6.72 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A022QK52 | 139-237 | PVEKIVENMEGVRCKRVARCISSVGLYVPGGTAVLPSTALMLSVPAQIAGCKTIVLATPPAQDGSICKEVLYCAKKAGVTHILKAGG… |
| A0A1I8AF09 | 2-99 | QDSWTYTEADGTVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVSEVVMVVPTPRGEINELVLAAACIAGVDRVFTIGGA… |
| A0A094A240 | 518-623 | None |
| A0A2K1QNJ2 | 97-194 | None |
| A0A5N5DSL0 | 888-995 | None |
| A0A316FPE0 | 106-197 | None |
| H0EXP9 | 266-361 | None |
| A0A447RKR2 | 107-210 | None |
| A0A0A0LVH0 | 747-845 | None |
| A0A0L8VW28 | 226-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.