DPCstruct | MC2836
Metacluster Properties and Pfam Annotations
| Number of structural domains | 387 |
|---|---|
| Mean domain length (aa) | 211 ± 47 aa |
| Standard deviation of domain lengths | 47.43 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 20.42 |
| Pfam Score | 99.74 |
| Assigned Pfam label(s) | CL0713- PF12076 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A836CGI7 | 17-208 | EMQRRGARLVLDSAAEALKCSLEASPLFAALSWLLKQDSLPLSTYQDIRERSFAYWICSVLLWFIIFDLLMYLQHRLTHSTRFLYDS… |
| A0A4Q1BZK6 | 21-237 | AGVYYLIFYVLFKRVFASKKIQAAYPKLGDYVREISYSLGTILLFALVPILIVQNPDIRPYTTVYDNIDDMGWGYYWFAYLLMFLMH… |
| A0A316KP76 | 35-303 | None |
| A0A2N0Q7U5 | 56-209 | None |
| A0A7R9KDT0 | 234-476 | None |
| A0A6S7GB33 | 679-919 | None |
| A0A5N4A789 | 5-124 | None |
| A0A822DQX7 | 9-143 | None |
| A0A5N6E850 | 5-267 | None |
| A0A1S3PFF0 | 3-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.