DPCstruct | MC28358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 109 ± 7 aa |
| Standard deviation of domain lengths | 6.88 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 47.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7QYA6 | 41-155 | QLLHQGVSTCHFAWAFHSEAEEELINMIPAIQRGDPQWSELRAMGIGWWVRNVNTLRRCIEKVAKASFQRNNDALDAALFYLSMKKK… |
| A0A1I8AB21 | 1-106 | HIIWALHSDAENELFNAIPCIQKSQPTWAELRNLGVLWWLKNSQALKTCVEKLAKAGFQLDQNPMDASLYYLALKKKNVLTHLFKSV… |
| G0P9M2 | 1-116 | None |
| A0A7R9E2C9 | 573-685 | None |
| A0A1I8MCS4 | 177-289 | None |
| A0A821UDT1 | 453-560 | None |
| A0A7R9AWJ0 | 771-883 | None |
| A0A6A4JVE6 | 759-871 | None |
| A0A7J7J3Q2 | 579-691 | None |
| A0A3Q0J1A3 | 354-454 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.